import gradio as gr from transformers import pipeline MODEL_ID = "sudhir2016/PLM" TASK = "text-classification" predictor = pipeline( task=TASK, model=MODEL_ID, device=-1 ) def predict_tm(sequence: str) -> str: spaced_sequence = " ".join(list(sequence.strip().upper())) result = predictor(spaced_sequence) predicted_tm = result[0]['score'] return f"Predicted Melting Temperature (Tm): {predicted_tm:.2f} °C" demo = gr.Interface( fn=predict_tm, inputs=gr.Textbox( label="Enter Protein Amino Acid Sequence (1-letter code)", placeholder="e.g., ACDEFGHIKLMNPQRSTVWY", lines=5 ), outputs="text", title="Nano Protein Language Model for Thermostability Prediction", description="Enter an amino acid sequence (using the 1-letter code) to predict its melting temperature (Tm) in degrees Celsius.", examples=[ ["VKLGSGAYE"], # Example sequence 1 ["MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKA"], # Example sequence 2 ] ) demo.launch()